PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g038350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 270aa    MW: 30218.8 Da    PI: 7.715
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g038350.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA633.5e-20198231134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C++C ttkTp+WR+gp+g++tLCnaCG+++r+ +
  Csa05g038350.1 198 CTHCETTKTPQWREGPRGPRTLCNACGVRFRSGR 231
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577166.65E-15191252No hitNo description
SMARTSM004011.0E-17192242IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.796192228IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.8E-15196229IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.31E-16197246No hitNo description
PROSITE patternPS003440198223IPR000679Zinc finger, GATA-type
PfamPF003206.4E-18198231IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MSNGSWLPEE DLKVLEDNFF DNLVDDIDDF PLENIETADD DEEDRVARPP PFDVLTSLYT  60
ELTCKNQASS SNVSSTVDSS PPDVKVLKLI QSISPVSVLE NTSGSALSHN QNIIQGLGAE  120
MSQQLVPDES ESETHLSSEN SAKKKRKKQK SLARKCTHCE TTSTPQRKKQ KSLARKCTHC  180
ETTSTPQRKK QKSPARKCTH CETTKTPQWR EGPRGPRTLC NACGVRFRSG RLFPEYRPAS  240
SPTFIPTVHS NMHRMIVEMR RKDEGQLDT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143147KKRKK
2144154KRKKQKSLARK
3166191RKKQKSLARKCTHCETTSTPQRKKQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010510637.10.0PREDICTED: putative GATA transcription factor 13 isoform X1
SwissprotQ9SKN63e-73GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLR0FY422e-98R0FY42_9BRAS; Uncharacterized protein
STRINGscaffold_401176.14e-97(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.15e-61GATA transcription factor 13